PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast10G005700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 651aa    MW: 72171.2 Da    PI: 6.108
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast10G005700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.36.1e-094094461954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  Brast10G005700.1.p 409 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 446
                         664459******************************88 PP

2BELL119.81.2e-38272343172
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         e+qelq+k akL+ +l+eVd++Yk+y++q+q v+ssF++vag gsakpYt++Al++iSrhFrcLkdai +qi
  Brast10G005700.1.p 272 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVSSFDVVAGPGSAKPYTAVALQTISRHFRCLKDAINDQI 343
                         689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.3E-56196341IPR006563POX domain
PfamPF075262.2E-50202339IPR006563POX domain
PROSITE profilePS5007112.357387450IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.1E-28389460IPR009057Homeodomain-like
SMARTSM003893.0E-9390454IPR001356Homeobox domain
CDDcd000864.43E-12390451No hitNo description
SuperFamilySSF466894.28E-17391457IPR009057Homeodomain-like
PfamPF059201.1E-17407446IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MATYYSSPGS ERESQDMYSR DPGGASYPMS SALGNLLYLN NPSSGPYTEF SGILQSQQNC  60
MEMPAHGHHS AMSQDSSVRE SDMLASHHGQ RSFGHVKDMK NEMLMHMMDG GQSGGAELIH  120
DDSHNGAQFE FGVLNNHGSS NVPSGQGQGQ GLSLSLNTQI MAPSLPYWSI KPDMLTPNSY  180
HESLRVDDIR MKTMQSEASR AIRHSRYLKA AQEVLDEVVN VWKNIKQKAQ KEQAEPEKAD  240
GKETDGGPKS EGVSSNPQES GANAAPELST AEKQELQNKM AKLMAMLDEV DRKYKHYYHQ  300
MQNVVSSFDV VAGPGSAKPY TAVALQTISR HFRCLKDAIN DQINVIRKKL GEEENSSGKE  360
GKLTRLRYID QQLRQQRAFQ QYGMIPQNAW RPQRGLPENS VTVLRAWLFE HFLHPYPKDS  420
EKLMLARQTG LTRSQISNWF INARVRLWKP MIEDMYKEET GDLEQDSNSS SDNVPRSKNK  480
VACSEENEDL KSARTRVCET SQLSESRASI GAMNAGGAPV GFQHEANPDD SFMNLMMKDQ  540
RSGEADGGLL LHNAMAQHSD ESARFMAYHL AELGRYGNGN VSLTLGLQHS GSGLSVPNAQ  600
ANFPGVTDDD MYNTAAPLGV SIASSDYESM NQIDQRQRFE QSPLLHDFVA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16396453158Homeobox protein Meis1
4xrs_B3e-16396453158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010236965.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_010236966.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_003575568.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLI1IG430.0I1IG43_BRADI; Uncharacterized protein
STRINGBRADI4G00740.20.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-110BEL1-like homeodomain 6